PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Han004409
Common Nameknot2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Heliantheae alliance; Heliantheae; Helianthus
Family TALE
Protein Properties Length: 346aa    MW: 38796.6 Da    PI: 6.6964
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Han#S44316196PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.82.2e-092763102155
                HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
   Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                k +yps++++  LA+++gL+++q+ +WF N+R ++
  Han004409 276 KWPYPSEAQKLALAESTGLDQKQINNWFINQRKRH 310
                569*****************************885 PP

2ELK41.23.5e-14230251122
        ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                ELK qLlrKYsgyLgsLkqEF+
  Han004409 230 ELKGQLLRKYSGYLGSLKQEFM 251
                9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012554.2E-2074118IPR005540KNOX1
PfamPF037902.6E-2376115IPR005540KNOX1
SMARTSM012563.6E-22140191IPR005541KNOX2
PfamPF037914.0E-21144190IPR005541KNOX2
PfamPF037895.7E-11230251IPR005539ELK domain
PROSITE profilePS5121311.174230250IPR005539ELK domain
SMARTSM011882.8E-8230251IPR005539ELK domain
PROSITE profilePS5007112.908250313IPR001356Homeobox domain
SuperFamilySSF466891.03E-19252327IPR009057Homeodomain-like
SMARTSM003896.0E-13252317IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.607.8E-28255315IPR009057Homeodomain-like
CDDcd000862.23E-12262314No hitNo description
PfamPF059204.8E-17270309IPR008422Homeobox KN domain
PROSITE patternPS000270288311IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 346 aa     Download sequence    Send to blast
MDCGDGGRSC NLMRFGDNHN NNGSGSLCVP QSSVVYNNTT LIFSPQDHHH RHHSNCGTSA  60
SAMMVEDHNT NSNSNVKAKI MSHPHYPRLL SAYLNCQKIG APPEVVERLE EACRSSLMAA  120
MSSRSGSDGA GTSGGGAGMS STIVGQDPAL DQFMEAYCEM LIKYEQELSK PFKEAMLFLS  180
RMESQFKAIT FSNSDSGCGE GGMDRNGSSE EELDVDMNNG MVDPQAEDRE LKGQLLRKYS  240
GYLGSLKQEF MKKRKKGKLP KEARQQLLDW WTRHYKWPYP SEAQKLALAE STGLDQKQIN  300
NWFINQRKRH WKPSEDMQFV VMDAAHPHYF IDNIFGNPYP MDVSLL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1245254LKQEFMKKRK
2251255KKRKK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002518420.11e-146PREDICTED: homeobox protein SBH1
SwissprotP466081e-140HSBH1_SOYBN; Homeobox protein SBH1
TrEMBLB2RG750.0B2RG75_HELAN; Putative knotted1-like protein
STRINGVIT_10s0116g00190.t011e-142(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.11e-127KNOX/ELK homeobox transcription factor